Krebszellen sind nimbler als nicht bösartige zellen


Krebszellen sind nimbler als nicht bösartige zellen

Hinweise darauf, wie Zellen krebsartig werden, zeigen sich in einem neuen Katalog ihrer physikalischen und chemischen Eigenschaften. Der Katalog zeigt unter anderem, wie bösartige Zellen, die aus Tumoren herausbrechen und andere Organe eindringen, nerviger und aggressiver sind als nicht-maligne: sie können durch kleine Räume leichter verlaufen und eine größere Kraft auf sie ausüben Umwelt.

Um den Katalog zu kompilieren, haben sich 100 Forscher aus 20 verschiedenen Zentren in den USA zusammengeschlossen, um die Physik und Chemie zu erforschen, die die Entwicklung von Krebszellen prägt, ein Prozess, der aus physikalisch-wissenschaftlicher Perspektive etwas unklar ist.

Die Forscher, die zu den Physikalischen Wissenschaften-Onkologie-Zentren (PS-OC) gehören, die vom National Cancer Institute gesponsert werden, hoffen, dass ihr Katalog die frühere Erkennung von Krebszellen unterstützen wird und sogar irgendwann helfen wird, metastasierten Krebs zu verhindern oder zu behandeln, das ist Krebs, der ist Hat verbreitet und begann neue Tumor-Sites in anderen Teilen des Körpers, und die für die überwiegende Mehrheit aller Krebs Todesfälle verantwortlich ist.

In einer Zeitung veröffentlicht am 26. April in der Zeitschrift Wissenschaftliche Berichte , Beschreiben sie, wie sie einen systematischen molekularen und biophysikalischen Vergleich zwischen zwei Zelllinien, einer der metastatischen Brustkrebszellen und der anderen von nicht-malignen Brustzellen durchgeführt haben, und aufgelisteten großen Unterschiede, die neue Einblicke in die Frage geben, wie sich die Zellen von nicht- Bösartig bis metastatisch.

Robert Austin, Professor für Physik und Leiter der Princeton University PS-OC in New Jersey, sagt in einer Erklärung:

"Durch die Zusammenführung unterschiedlicher experimenteller Kompetenzen, um metastatische und nichtmetastatische Zellen systematisch zu vergleichen, haben wir unser Wissen darüber, wie Metastasen auftreten, vorangetrieben."

Metastatische Zellen sind im Wesentlichen "Jailbreakers"

Zum Beispiel fanden sie, dass die beiden Arten von Zelle Unterschiede in den mechanischen Eigenschaften zeigten, wie sie an Oberflächen kleben, wie sie migrieren, auf Sauerstoff reagieren und Protein produzieren.

Austin und das Team im Princeton PS-OC entdeckten, dass, obwohl sie langsamer als nicht-maligne Zellen reisen, Metastatische Zellen fahren weiter und gehen in eine gerader Linie .

Sie schufen eine Umgebung aus Silizium, die die Struktur des Gewebes im Inneren des Körpers simuliert und beobachtet, was passiert ist, als die Zellen ihren Weg durch winzige zellgroße Kammern und Kanäle, die im Silizium geätzt wurden,

Austin sagt Metastatische Zellen "sind im Wesentlichen Jailbreakers", weil sie durch die extrazelluläre Matrix brechen können , Die harte Membranwand, die der Körper schafft, um den Tumor von gesundem Gewebe abzudichten.

Princetons Physiker und Ingenieure verfügen über Kompetenz in der Mikrofertigungstechnik, mit der integrierte Schaltungen und Solarzellen hergestellt werden. Sie haben dieses Fachwissen aufgerufen, um die winzigen Siliziumkammern in der Studie zu machen.

Der Princeton PS-OC umfasst auch Teams aus der Johns Hopkins University School of Medicine, dem Salk Institute for Biological Studies und der University of California - Santa Cruz.

Metastatische Zellen mehr elastisch zu niedrigem Sauerstoff und machen Proteine, die sie mehr mobil machen

In ihrer Arbeit beschreiben die Forscher auch, wie sie gefunden haben Metastatische Zellen erholen sich schneller von der Belastung einer Umgebung mit niedrigem Sauerstoffgehalt Als nicht maligne Zellen, die Ergebnisse früherer Studien bestätigen.

Viele metastatische Zellen gehen zugrunde, wenn die Sauerstoffversorgung niedrig ist, aber diejenigen, die überleben mit großer Kraft überleben und bestätigen die Ansicht, dass einzelne Zellen eine wichtige Rolle bei der Ausbreitung von Krebs spielen.

Das Princeton PS-OC entdeckte auch Bösartige Zellen machen Proteine, die sie mobiler machen Und in der Lage, die extrazelluläre Matrix eindringen und entkommen dem Tumor. Sie entdeckten dies durch den Vergleich der gesamten Proteinproduktion mit der in metastatischen Zellen produzierten.

Messen, wie Zellen auf umgebende Zellen zur Expression von Genen und Proteinen drängen

Über alle PS-OC-Netzwerk, die Forscher verwenden die gleichen zwei Brust-Epithel-Zelllinien: nicht-tumorigenen MCF-10A und metastasierten MDA-MB-231, häufig verwendeten Modelle der Krebsmetastase. Sie verwenden auch die gleichen Reagenzien und Protokolle, so dass Ergebnisse verglichen werden können.

Ihre Labormethoden reichten davon ab, physikalische Maßnahmen zu ergreifen, wie die Zellen auf umliegende Zellen drängen, um ihre Gen- und Proteinexpression zu messen.

Nastaran Zahir Kuhn, Programmleiter für das PS-OC am National Cancer Institute, sagt in einer Erklärung:

"Etwa 20 Techniken wurden verwendet, um die Zelllinien zu studieren, so dass die Identifizierung einer Reihe von einzigartigen Beziehungen zwischen Beobachtungen."

Metastatische Zellen sind weicher und üben mehr Kraft auf ihre Umgebung

Zum Beispiel, mit einer Technik namens Atomkraft-Mikroskopie, fanden die Forscher, dass metastatische Zellen scheinen weicher als nicht-maligne Zellen, während ein anderer Ansatz, genannt Traktionskraft Mikroskopie, zeigte sie mehr Kraft auf ihre Umgebung.

Diese beiden Eigenschaften geben wichtige Hinweise darauf, wie metastatische Zellen ihrem ummauerten Tumorgefängnis entkommen. Diese könnten ihnen zum Beispiel helfen, an der Migration teilnehmen und die harte extrazelluläre Matrix umbauen, die der Körper mit dem Tumor umgeben hat. Aber zur gleichen Zeit, da weicher, können metastatische Zellen auch durch die kleinen Räume in der Membran quetschen.

Kuhn sagt, dass das Ziel des bundesweiten PS-OC-Programms darin besteht, das Fachwissen von Physikern, Ingenieuren, Informatikern, Chemikern und Biologen zu integrieren, um uns besser zu helfen, Krebs zu verstehen und:

"Die Ergebnisse dieser Studie zeigen den Nutzen eines solchen Ansatzes, besonders wenn die Studien von Anfang an standardisiert durchgeführt werden."

In einer weiteren faszinierenden Studie, die im Januar 2013 veröffentlicht wurde, können Forscher, die die Interaktion zwischen Zellen und der extrazellulären Matrix untersuchen, darauf hinweisen, wie die Zellen wissen, dass sie nicht auf dem Kopf sind, auch dazu beitragen können, Krebs zu bekämpfen.

KREBS: Das wichtigste Video! Keine "Krebszellen" sondern Parasiten (Video Medizinische Und Professionelle 2018).

Abschnitt Probleme Auf Medizin: Krankheit